PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_37040V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 490aa    MW: 54197.6 Da    PI: 6.9144
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_37040V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.8e-161865148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT++Ed++l+ +++ +G g+W++ +   g+ R++k+c++rw +yl
  Pp3c2_37040V3.1.p 18 KGPWTPDEDQKLLAYIQNHGHGSWRSLPLNAGLQRCGKSCRLRWTNYL 65
                       79********************************************97 PP

2Myb_DNA-binding57.33.6e-1871116148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rgr+++eEd+ +v++++ lG++ W++Ia++++ +Rt++++k++w+++l
  Pp3c2_37040V3.1.p  71 RGRFSQEEDQMIVHLHAILGNR-WSAIASHLP-RRTDNEIKNYWNTHL 116
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.211365IPR017930Myb domain
SuperFamilySSF466893.03E-3015112IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-231568IPR009057Homeodomain-like
SMARTSM007176.0E-121767IPR001005SANT/Myb domain
PfamPF002498.4E-151865IPR001005SANT/Myb domain
CDDcd001675.07E-102065No hitNo description
PROSITE profilePS5129427.30966120IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2769120IPR009057Homeodomain-like
SMARTSM007174.2E-1870118IPR001005SANT/Myb domain
PfamPF002493.2E-1671116IPR001005SANT/Myb domain
CDDcd001672.17E-1373116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MTRVPLGSVG EKECGLKKGP WTPDEDQKLL AYIQNHGHGS WRSLPLNAGL QRCGKSCRLR  60
WTNYLRPDIK RGRFSQEEDQ MIVHLHAILG NRWSAIASHL PRRTDNEIKN YWNTHLKKRL  120
LQMGIDPVTH KSTTAEELLL DSILPALRPT ISSNLSHTSQ WEIARAEAEI RLSQQSSLNS  180
ASNLKPSLQQ CNLSTKTNPN HSASTNFMDT WKAQVAETLR PNFGAVELDN SPANPVNLQA  240
FLLDWESSLQ APQAHMKQFS AYDSPINISD LSTGGAPELV SAQYNPKGSQ CTMEGSSSIF  300
PVAAQSSERF FTSRRGTLPA SRIDLESRES ARLSSMFSLS RVNSVSDSHS LSGAGSSFNY  360
SGACTDIDNQ FSPTSTLNAP DRDSSYTNSP CGSSNSHSEC FDLLPQNYPL LHPDNIVEQS  420
ENNLVLPREQ TFWSRKQVAM VEAFPPEPYF FSELELASQK PPSFSIGSTA PMLHQVGVPN  480
IPLLHFNSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28161205108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001751220.10.0predicted protein, partial
SwissprotP800741e-114MYB1_PHYPA; Myb-related protein Pp1 (Fragment)
TrEMBLA9RAV40.0A9RAV4_PHYPA; Uncharacterized protein (Fragment)
STRINGPP1S1_78V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.18e-78myb domain protein 16